Jump to content

Folding@home: la Team INpact qui guérit la planète


Will.
 Share

Recommended Posts

En passant je me demande si c pas sponsorisés par les fabricants de procos, car ça donne envie d en changer pour aller plus vite ;p

Bon sinon vous inquietez pas, le nombre de membres [inpact] devrait augmenter mais vu que je me susi tapé une proteine à 400 frames faut environ 21h pour la cacluler en tout.

400 frames ?

c koi ca ?

c le nb d "iterations" ou le nb de "position in protein" ?

Link to comment
Share on other sites

[21:35:28] + Attempting to get work packet

[21:35:28] - Connecting to assignment server

[21:35:29] - Successful: assigned to (171.64.122.121).

[21:35:29] + News From Folding@Home: Welcome to Folding@Home

[21:35:29] Loaded queue successfully.

[21:35:30] - Deadline time not received.

[21:35:33] + Could not get Work unit data from Work Server

[21:35:33] - Error: Getwork #4 failed, and no other work to do. Waiting before retry

pkoi ca fait ca ??? (ca a marcje k apres 5 essais)

Link to comment
Share on other sites

pkoi c pas du tt kom la premiere ?

j avais ca

[11:31:18] [sPG] Designing protein sequence 1 of 30

[11:34:57] [sPG] 10.0

[11:39:37] [sPG] 20.0

[11:44:13] [sPG] 30.0

[11:47:34] [sPG] 40.0

[11:51:04] [sPG] 50.0

[11:54:35] [sPG] 60.0

[11:57:50] [sPG] 70.0

[12:01:01] [sPG] 80.0

[12:04:14] [sPG] 90.0

[12:07:32] [sPG] 100.0

[12:07:32] [sPG] Writing current.xyz

[12:07:32] [sPG] Sequence 1 completed:

[12:07:32] KSEWATHKFYSTVYFVNIEVWHINFDPVYIKSVICAATQPCPNNLMNYIR . . .

[12:07:33] Iterations: 20 of 600

[12:07:34] Finished

...

et maintenant

[21:41:03] Finished a frame (1)

[21:47:49] Finished a frame (2)

[21:51:35] Finished a frame (3)

...

dsl pour ttes ces kestions :craint:

Link to comment
Share on other sites

pkoi c pas du tt kom la premiere ?

j avais ca

[11:31:18] [sPG] Designing protein sequence  1 of 30                    

[11:34:57] [sPG]  10.0  

[11:39:37] [sPG]  20.0  

[11:44:13] [sPG]  30.0  

[11:47:34] [sPG]  40.0  

[11:51:04] [sPG]  50.0  

[11:54:35] [sPG]  60.0  

[11:57:50] [sPG]  70.0  

[12:01:01] [sPG]  80.0  

[12:04:14] [sPG]  90.0  

[12:07:32] [sPG] 100.0  

[12:07:32] [sPG] Writing current.xyz                                    

[12:07:32] [sPG] Sequence  1 completed:                                

[12:07:32] KSEWATHKFYSTVYFVNIEVWHINFDPVYIKSVICAATQPCPNNLMNYIR . . .    

[12:07:33] Iterations: 20 of 600

[12:07:34] Finished

...

Ca c'est une WU Genome (fahcoreca) ... apparaisant comme le projet 799 sur ta page des stats ...

et maintenant

[21:41:03] Finished a frame (1)

[21:47:49] Finished a frame (2)

[21:51:35] Finished a frame (3)

...

Et c'est une WU Folding utilisant le core Tinker (fahcore65) ...

dsl pour ttes ces kestions :craint:

Link to comment
Share on other sites

[21:35:28] + Attempting to get work packet

[21:35:28] - Connecting to assignment server

[21:35:29] - Successful: assigned to (171.64.122.121).

[21:35:29] + News From Folding@Home: Welcome to Folding@Home

[21:35:29] Loaded queue successfully.

[21:35:30] - Deadline time not received.

[21:35:33] + Could not get Work unit data from Work Server

[21:35:33] - Error: Getwork #4 failed, and no other work to do. Waiting before retry

pkoi ca fait ca ??? (ca a marcje k apres 5 essais)

Le serveur était à sec ... pas de WU dispo ... ou alors un arret par l'équipe ... c'est pas grave en général : suffit soit d'attendre ... soit de couper et relancer le client pour être assigné à un autre serveur.

Link to comment
Share on other sites

Guest nightswan

Salut !

Encore une ptite question :

[01:15:56] - User ID not found locally

[01:15:56] + Requesting User ID from server

[01:15:56] + Could not connect to Primary Assignment Server for ID

[01:15:56] + Could not connect to Secondary Assignment Server for ID

Faut impérativement être connecté à l'installation et quand le calcul d'une protéine est fini, mais PAS pendant le calcul, right ?

Or, hier j'ai voulu relancer le prog au démarrage du PC, et ça marchait pas . Comme j'étais dans l'impossibilité de me connecter à ce moment là, ben j'ai pas pu lancer le travail.

Ca doit sûrement venir du fait que le prog n'a pas trouvé mon ID localement, donc pourquoi ça m'a fait ça ? :craint:

Link to comment
Share on other sites

Guest nightswan
petite maj par rapport àF@H (Folding) et S@H (Génome) (...)

La grande différence entre les 2 est que Génome n'a pas de dead-line, ce qui veut direque si vous passer + d'une semaine dessus, la WU ne sera pas donnée à qqun d'autre alors que pour les autres WUs il y a un dead-line d'une semaine ou 6 jours, je ne sais plus, et contrarement à Séti, la WUs renvoyé en retard NE sera PAS comptabilisée...

Encore 2 questions qui me turlupinent :yes:

Voilà mon log de ce matin :

[03:24:29] + Attempting to get work packet

[03:24:29] - Connecting to assignment server

[03:24:41] - Successful: assigned to (171.64.122.119).

[03:24:41] + News From Folding@Home: Welcome to Folding@Home

[03:24:41] Loaded queue successfully.

[03:24:45] - Deadline time not received.

[03:25:39] + Closed connections

[03:25:39]

[03:25:39] + Processing work unit

[03:25:39] Core required: FahCore_65.exe

[03:25:39] Core not found.

Sans deadline, est-ce que le travail que je suis en train de faire sera comptabilisé une fois fini ou pas :craint:

[03:28:43] - Couldn't get size info for dyn file: work/wudata_03.dyn

[03:28:43] Starting from initial work packet

[03:28:43]

[03:28:43] Protein: p660_1LE0_273K

[03:28:43] - Run: 23 (Clone 25, Gen 0)

[03:28:43] - Frames Completed: 0, Remaining: 400

[03:28:43] - Dynamic steps required: 5000000

C'est gênant ou pas de pas avoir eu cette info de taille du dyn file :D

Merci d'avance :-D

Link to comment
Share on other sites

http://pages.infinit.net/jgpoulin/IMPACT.htm

pourquoi y a iMpact la aussi?? c'est po corrigé ? ou c'est pô cette page qui était foireuse déjà?

Ca a été corrigé ... mais comme je l'ai déjà dit, cette page est mise à jour un fois par jour vers 22H, heure du quebec ! :yes:

:craint: désolé...j'l'avais lu en+...olalalala...c'est du a l'heure tardive...diminution de mes facultées... :D

:-D

Link to comment
Share on other sites

petite maj par rapport àF@H (Folding) et S@H (Génome) (...)

La grande différence entre les 2 est que Génome n'a pas de dead-line, ce qui veut direque si vous passer + d'une semaine dessus, la WU ne sera pas donnée à qqun d'autre alors que pour les autres WUs il y a un dead-line d'une semaine ou 6 jours, je ne sais plus, et contrarement à Séti, la WUs renvoyé en retard NE sera PAS comptabilisée...

Encore 2 questions qui me turlupinent :yes:

Voilà mon log de ce matin :

[03:24:29] + Attempting to get work packet

[03:24:29] - Connecting to assignment server

[03:24:41] - Successful: assigned to (171.64.122.119).

[03:24:41] + News From Folding@Home: Welcome to Folding@Home

[03:24:41] Loaded queue successfully.

[03:24:45] - Deadline time not received.

[03:25:39] + Closed connections

[03:25:39]

[03:25:39] + Processing work unit

[03:25:39] Core required: FahCore_65.exe

[03:25:39] Core not found.

Sans deadline, est-ce que le travail que je suis en train de faire sera comptabilisé une fois fini ou pas :craint:

[03:28:43] - Couldn't get size info for dyn file: work/wudata_03.dyn

[03:28:43] Starting from initial work packet

[03:28:43]

[03:28:43] Protein: p660_1LE0_273K

[03:28:43] - Run: 23 (Clone 25, Gen 0)

[03:28:43] - Frames Completed: 0, Remaining: 400

[03:28:43] - Dynamic steps required: 5000000

C'est gênant ou pas de pas avoir eu cette info de taille du dyn file :D

Merci d'avance :-D

je pense pas ke ce soit un pb pcq g eu exactement la meme chose hier soir qd g commence un nouvo projet

Link to comment
Share on other sites

ta vu william est chez alliance franco et en meme temps chez F@H :mdr:

tu peux faire la meme chose demande a totow :D

jpense que si tu plie du G@H tu peux po faire partie du F@H.... .....prends la console graphique et choisis de plier que les projets F@H et tu sra ds la team une fois que tora plié un wu :D:mdr:

Link to comment
Share on other sites

Bon,

[10:33:14] Finished a frame (398)

[10:36:14] Finished a frame (399)

[10:39:15] Finished a frame (400)

[10:39:15] TINKER is Exiting following Normal Termination

[10:39:15]

[10:39:15] Finished Work Unit:

[10:39:20] ARC file integrity verified

[10:39:20] logfile size: 20480

[10:39:20] Leaving Run

[10:39:23] - Writing 628664 bytes of core data to disk.

[10:39:23] end (WriteWorkResults)

[10:39:23] - Shutting down core

[10:39:23]

[10:39:23] Folding@Home2 Core Shutdown: FINISHED_UNIT

[10:39:26] CoreStatus = 64 (100)

[10:39:26] Sending work to server

[10:39:26] + Attempting to send results

[10:40:08] + Results successfully sent

[10:40:08] Thank you for your contribution to Folding@home.

[10:40:08] + Starting local stats count at 1

[10:40:12] + Attempting to get work packet

[10:40:12] - Connecting to assignment server

[10:40:13] - Successful: assigned to (171.64.122.108).

[10:40:13] + News From Folding@Home: Welcome to Folding@Home

[10:40:13] Loaded queue successfully.

[10:40:15] + Closed connections

[10:40:15]

[10:40:15] + Processing work unit

[10:40:15] Core required: FahCore_65.exe

[10:40:15] Core found.

[10:40:15] Working on Unit 03 [April 19 10:40:15]

[10:40:15] + Working ...

[10:40:16] Folding@Home Client Core Version 2.47 (June 14, 2002)

j'a fait mes 400 frames...mais je vois tjrs pô mon nom dans la liste...

m'enfin ...!!! :D

p'têt demain....vé attendre encore un peu....

Link to comment
Share on other sites

ta vu william est chez alliance franco et en meme temps chez F@H :mdr:

tu peux faire la meme chose demande a totow :D

jpense que si tu plie du G@H tu peux po faire partie du F@H.....prends la console graphique et choisis de plier que les projets F@H et tu sra ds la team une fois que tora plié un wu  :D  :mdr:

elle plante la version graph (et puis c pas la console graphique :8 )

Link to comment
Share on other sites

[03:24:45] - Deadline time not received.

[03:28:43] - Couldn't get size info for dyn file: work/wudata_03.dyn

Normal que tu n'aie pas de deadline, seul les projets Gromacs en fournissent une au client (fahcore78) ... mais elle existe bel bien :mdr: voir le liste des projets sur le site de l'alliance ...

Couldn't get ... c'est normal aussi lorsque tu démarre juste un calcul : ca veut dire qu'il n'a pas trouvé de points de sauvegarde ... (logique, il a rien calculé encore) :D

Link to comment
Share on other sites

Salut !

Encore une ptite question :  

[01:15:56] - User ID not found locally

[01:15:56] + Requesting User ID from server

[01:15:56] + Could not connect to Primary Assignment Server for ID

[01:15:56] + Could not connect to Secondary Assignment Server for ID

Faut impérativement être connecté à l'installation et quand le calcul d'une protéine est fini, mais PAS pendant le calcul, right ?

Or, hier j'ai voulu relancer le prog au démarrage du PC, et ça marchait pas . Comme j'étais dans l'impossibilité de me connecter à ce moment là, ben j'ai pas pu lancer le travail.

Ca doit sûrement venir du fait que le prog n'a pas trouvé mon ID localement, donc pourquoi ça m'a fait ça ? :D

Lors de l'installation du client il faut être connecté ... il va récupérer un userID, puis du travail ... :D et là t'es tranquille pour quelques heures ...

Pour ton lancement au démarrage ... t'as fait comment ? :mdr: Il vaut mieux que le client soit configuré avant de commencer à le lancer au démarrage ... Tu utilise plusieurs comptes utilisateur ? :mdr:

Link to comment
Share on other sites

Join the conversation

You can post now and register later. If you have an account, sign in now to post with your account.

Guest
Reply to this topic...

×   Pasted as rich text.   Paste as plain text instead

  Only 75 emoji are allowed.

×   Your link has been automatically embedded.   Display as a link instead

×   Your previous content has been restored.   Clear editor

×   You cannot paste images directly. Upload or insert images from URL.

 Share

×
×
  • Create New...